PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002135.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 332aa    MW: 37998.8 Da    PI: 9.0348
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002135.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.54.8e-48131382128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                              ppG+rFhP+d+el+v+yL +kv++++l++  +i++v+ y+++PwdLpk +  +e+ew+fFs+rd+ky++g r+nr+t+sgyWkatg
  Itr_sc002135.1_g00002.1  13 PPGVRFHPSDQELIVYYLFNKVNSHPLPA-CIITDVKFYNYNPWDLPKLAIFGEDEWFFFSPRDRKYPNGVRPNRTTASGYWKATG 97 
                              9**************************99.78***************75556899******************************* PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +d+++ls +g+++g+kk Lvfy g+ap+g ktdW m eyrl
  Itr_sc002135.1_g00002.1  98 SDRPILSPDGSKIGVKKALVFYIGKAPSGLKTDWNMMEYRL 138
                              ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-596166IPR003441NAC domain
PROSITE profilePS5100555.06612166IPR003441NAC domain
PfamPF023659.5E-2413138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MASRPAISSF HFPPGVRFHP SDQELIVYYL FNKVNSHPLP ACIITDVKFY NYNPWDLPKL  60
AIFGEDEWFF FSPRDRKYPN GVRPNRTTAS GYWKATGSDR PILSPDGSKI GVKKALVFYI  120
GKAPSGLKTD WNMMEYRLPD TSIKPSRPKG SSMRLDDWVL CRVRQKGNMS KNAWEAQPSP  180
QELLSYLPNN EKLPSVNDDP LRDINTNYLL TKDNSLIYSM FLQGLIPLEN ILRAASQFSS  240
DGKYYTGYEH ESGKVNTQVT NSSFQSFFGS SKRKHDDGTK YQNPHDLIKT ISDGNKSEDF  300
LLSNMLDTNH RNFYNENQPP VDTFSGIQYQ MP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-6331756173Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065118.11e-100PREDICTED: NAC domain-containing protein 68-like
SwissprotQ8GY428e-68NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A068UFT81e-109A0A068UFT8_COFCA; Uncharacterized protein
STRINGVIT_06s0004g03080.t011e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA133901117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.14e-69NAC domain containing protein 25